Germany
Japan
United Kingdom
China
USD 478.00
In Stock
Primary Antibodies
View as table Download
USD 600.00
3 Days
SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 447.00
In Stock
USD 550.00
5 Days
Mouse Monoclonal Glucose 6 Phosphate Dehydrogenase Antibody (2H7) Cytosol Marker
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336922 is a replacement of AM06697SU-N.
USD 200.00
In Stock
Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Glutathione Peroxidase 4 (184-196) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEPLVIEKDLPHY, from the C-Terminus of protein sequence according to NP_002076.2NP_001034937.1. |
USD 458.00
In Stock
USD 458.00
In Stock
Rabbit Polyclonal Anti-GCLM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Glutathione metabolism
Citations
- Yes