NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-NEU1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACER1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD |
UGT8 rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human Ceramide Glycosyltransferase Protein |
NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".