Primary Antibodies

View as table Download

Rabbit Polyclonal Lipase A Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571]

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.

Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12)

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Rabbit Polyclonal ASAH1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1.

Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.

Rabbit Polyclonal Anti-CTSL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTSL

Rabbit polyclonal AP1M1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen This AP1M1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 199-227 amino acids from the Central region of human AP1M1.

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.

Rabbit Polyclonal AP3S1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AP3S1 antibody was raised against a 19 amino acid synthetic peptide near the center of human AP3S1.

SLC11A2 / DMT1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Gibbon (Predicted: Monkey, Bovine, Pig)
Conjugation Unconjugated
Immunogen SLC11A2 / DMT1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Pig (93%); Dog, Rabbit (87%); Marmoset, Panda (80%).

Goat Polyclonal Antibody against Arylsulfatase B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLARGHTNGTKPLD, from the internal region of the protein sequence according to NP_000037.2; NP_942002.1.