Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-MCM3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE |
Rabbit Polyclonal Anti-MCM6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
Rabbit Polyclonal Anti-MCM6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV |
Rabbit polyclonal anti-MCM2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Saccharomyces cerevisiae |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 21-31 of human MCM2 protein (see below). |
MCM7 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 113-142 amino acids from the N-terminal region of human MCM7 |
Rabbit Polyclonal Anti-MCM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE |
Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the N terminal of human MCM7. Synthetic peptide located within the following region: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- DNA replication