Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Primary Antibodies
Download
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against Nucleophosmin, mutant - AML Marker
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of human mutant nucleophosmin (exact sequence is within residues 250-298). |
Rabbit polyclonal TK (Ab-13) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-OTX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Active filters
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- P53 (37)
- CHK1 (17)
- BCL2 (15)
- CASPASE-6 (14)
- CHK2 (14)
- HDAC2 (14)
- CASPASE 9 (13)
- HDAC1 (13)
- LCK (12)
- PAXILLIN (12)
- CDK1 (11)
- PAK1 (11)
- SOCS1 (11)
- C-MYC (10)
- CYCLIN B1 (10)
- HSP90AB1 (10)
- IKB BETA (10)
- VASP (10)
- OCT4 (9)
- PCNA (9)
- THYMIDINE KINASE 1 (9)
- C-MYB (8)
- CD117 (8)
- CDK7 (8)
- CYCLIN D1 (8)
- DNMT3B (8)
- MRE11 (8)
- NUCLEOPHOSMIN (8)
- PARP1 (8)
- PIAS2 (8)
- RPA34 (8)
- APE1 (7)
- AURORA A (7)
- BIRC5 (7)
- CYCLIN E1 (7)
- GOT2 (7)
- KU80 (7)
- MCM3 (7)
- PHAP1 (7)
- RAD51 (7)
- SHP1 (7)
- AATF (6)
- ACTIN (6)
- AIMP2 (6)
- ANNEXIN A2 (6)
- BAK (6)
- CARDIAC TROPONIN I (6)
- CTBP2 (6)
- EWSR1 (6)
- GTF2H2 (6)
- HSP60 (6)
- MCM5 (6)
- MYH (6)
- ATIC (5)
- CYCLIN A2 (5)
- GRP75 (5)
- HMG1 (5)
- HMGA1 (5)
- HSC70 (5)
- HSP105 (5)
- KPNA2 (5)
- MBD2 (5)
- MCM6 (5)
- NANOG (5)
- NUCLEOLIN (5)
- PININ (5)
- PSMD11 (5)
- REX1 (5)
- SIRT1 (5)
- SMN1 (5)
- SP1 (5)
- STIP1 (5)
- UNG (5)
- ARID3B (4)
- AURORA B (4)
- CDC2 (4)
- CDC25C (4)
- COPS3 (4)
- CPN10 (4)
- CXADR (4)
- DAZAP1 (4)
- EBP1 (4)
- ERBB 3 (4)
- EXOSC3 (4)
- FEN1 (4)
- FUBP1 (4)
- HPRT (4)
- KAP1 (4)
- KAT7 (4)
- LAP2 (4)
- MCM2 (4)
- MCM4 (4)
- MNAT1 (4)
- MYBBP1A (4)
- NAC1 (4)
- NM23A (4)
- NUCLEOSTEMIN (4)
- OTX2 (4)
- PAK3 (4)
- PRMT5 (4)
Reactivities
- Human (983)
- Mouse (558)
- Rat (435)
- Dog (47)
- Bovine (40)
- Pig (33)
- Monkey (25)
- Cow (23)
- Chicken (20)
- Hamster (11)
- Rhesus Monkey (9)
- Xenopus (9)
- Chimpanzee (8)
- Rabbit (6)
- X. tropicalis (6)
- Canine (4)
- Feline (4)
- Zebrafish (4)
- Sheep (3)
- Goat (2)
- Primate (2)
- Algal (1)
- Canis (1)
- Drosophila (1)
- Equine (1)
- Fish (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Saccharomyces cerevisiae (1)
Antibody Hosts
Conjugates
Modifications
Assay Types
Pathways
- Cell cycle (217)
- Pathways in cancer (171)
- p53 signaling pathway (124)
- Small cell lung cancer (99)
- Colorectal cancer (97)
- Prostate cancer (90)
- Chronic myeloid leukemia (88)
- Huntington's disease (85)
- Apoptosis (79)
- DNA replication (70)
- MAPK signaling pathway (69)
- Endometrial cancer (68)
- Amyotrophic lateral sclerosis (ALS) (67)
- Pancreatic cancer (65)
- Metabolic pathways (64)
- Wnt signaling pathway (63)
- Neurotrophin signaling pathway (62)
- Focal adhesion (61)
- Nucleotide excision repair (61)
- Non-small cell lung cancer (58)
- Bladder cancer (55)
- Thyroid cancer (55)
- Base excision repair (52)
- Mismatch repair (48)
- Progesterone-mediated oocyte maturation (48)
- Oocyte meiosis (47)
- Glioma (45)
- Melanoma (45)
- Jak-STAT signaling pathway (44)
- T cell receptor signaling pathway (44)
- Basal cell carcinoma (37)
- Homologous recombination (36)
- Chemokine signaling pathway (33)
- Notch signaling pathway (33)
- Regulation of actin cytoskeleton (32)
- Natural killer cell mediated cytotoxicity (30)
- Spliceosome (30)
- ErbB signaling pathway (29)
- Acute myeloid leukemia (26)
- VEGF signaling pathway (25)
- Viral myocarditis (25)
- RNA degradation (24)
- Pyrimidine metabolism (23)
- Fc gamma R-mediated phagocytosis (22)
- Leukocyte transendothelial migration (22)
- Purine metabolism (22)
- Ubiquitin mediated proteolysis (22)
- Antigen processing and presentation (20)
- NOD-like receptor signaling pathway (20)
- Non-homologous end-joining (19)
- Endocytosis (18)
- Gap junction (18)
- B cell receptor signaling pathway (17)
- Primary immunodeficiency (17)
- Alzheimer's disease (16)
- Drug metabolism - other enzymes (16)
- Parkinson's disease (16)
- Proteasome (16)
- Axon guidance (15)
- Cysteine and methionine metabolism (15)
- Renal cell carcinoma (15)
- TGF-beta signaling pathway (15)
- Insulin signaling pathway (14)
- Cytosolic DNA-sensing pathway (12)
- Cytokine-cytokine receptor interaction (11)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Type II diabetes mellitus (11)
- Adipocytokine signaling pathway (10)
- RIG-I-like receptor signaling pathway (10)
- One carbon pool by folate (9)
- Hematopoietic cell lineage (8)
- Melanogenesis (8)
- Pathogenic Escherichia coli infection (8)
- Adherens junction (7)
- Alanine (7)
- Arginine and proline metabolism (7)
- Calcium signaling pathway (7)
- Phenylalanine (7)
- Phenylalanine metabolism (7)
- Prion diseases (7)
- Tyrosine metabolism (7)
- aspartate and glutamate metabolism (7)
- tyrosine and tryptophan biosynthesis (7)
- Basal transcription factors (6)
- Cardiac muscle contraction (6)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Type I diabetes mellitus (6)
- Systemic lupus erythematosus (4)
- Fructose and mannose metabolism (3)
- Glycine (3)
- Glycolysis / Gluconeogenesis (3)
- Glyoxylate and dicarboxylate metabolism (3)
- Pentose phosphate pathway (3)
- Steroid biosynthesis (3)
- serine and threonine metabolism (3)
- RNA polymerase (2)
- SNARE interactions in vesicular transport (2)
- Selenoamino acid metabolism (2)
- ECM-receptor interaction (1)
- Ether lipid metabolism (1)
- Folate biosynthesis (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Nicotinate and nicotinamide metabolism (1)
- Sphingolipid metabolism (1)