Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit polyclonal anti-BRCA2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human BRCA2. |
Anti-RAD50 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
TA321721 is a possible alternative to TA321722.
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit Polyclonal Anti-RAD51 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit polyclonal Anti-RPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- WB
Isotypes
- IgG
Pathways
- Homologous recombination