Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against Nucleophosmin, mutant - AML Marker
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of human mutant nucleophosmin (exact sequence is within residues 250-298). |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit Polyclonal Exosome Component 9 Antibody
| Applications | ChIP, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human EXOSC9 protein (within residues 250-439). [Swiss-Prot Q06265] |
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Active filters
Applications
- IP
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
- BCL2 (2)
- C-MYC (2)
- CASPASE 9 (2)
- CDK1 (2)
- KU80 (2)
- MRE11 (2)
- APE1 (1)
- BAK (1)
- BIRC5 (1)
- CASPASE-6 (1)
- EXOSOME COMPONENT 9 (1)
- FEN1 (1)
- GRP75 (1)
- HDAC1 (1)
- HDAC2 (1)
- KPNA2 (1)
- LSM4 (1)
- MCM3 (1)
- MCM5 (1)
- MCM6 (1)
- MNAT1 (1)
- NUCLEOPHOSMIN (1)
- P53 (1)
- PSMA3 (1)
- RFC4 (1)
- RPA34 (1)
- SET (1)
- SMARCC1 (1)
- TPX2 (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Assay Types
Pathways
- Cell cycle (10)
- Pathways in cancer (10)
- Colorectal cancer (8)
- Small cell lung cancer (7)
- Apoptosis (6)
- DNA replication (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Chronic myeloid leukemia (5)
- Endometrial cancer (5)
- Huntington's disease (5)
- Non-homologous end-joining (5)
- Prostate cancer (5)
- p53 signaling pathway (5)
- Bladder cancer (3)
- Homologous recombination (3)
- MAPK signaling pathway (3)
- Neurotrophin signaling pathway (3)
- Non-small cell lung cancer (3)
- Nucleotide excision repair (3)
- Pancreatic cancer (3)
- RNA degradation (3)
- Thyroid cancer (3)
- Wnt signaling pathway (3)
- Acute myeloid leukemia (2)
- Alzheimer's disease (2)
- Base excision repair (2)
- ErbB signaling pathway (2)
- Focal adhesion (2)
- Gap junction (2)
- Jak-STAT signaling pathway (2)
- Mismatch repair (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- Parkinson's disease (2)
- Progesterone-mediated oocyte maturation (2)
- TGF-beta signaling pathway (2)
- VEGF signaling pathway (2)
- Viral myocarditis (2)
- Basal cell carcinoma (1)
- Glioma (1)
- Melanoma (1)
- Proteasome (1)
- Spliceosome (1)