CD3E (Cytopl. Dom.) rat monoclonal antibody, clone CD3-12, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Canine, Chicken, Equine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
CD3E (Cytopl. Dom.) rat monoclonal antibody, clone CD3-12, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Canine, Chicken, Equine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
Applications | ELISA, IHC, WB |
Reactivities | Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3. |
Mouse Monoclonal Cytochrome c Antibody (7H8.2C12)
Applications | FC, ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Mouse, Canine, Drosophila, Equine, Mammalian |
Conjugation | Unconjugated |
USD 570.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
USD 315.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Dopamine beta Hydroxylase (DBH) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Equine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal AG-2 Antibody (10E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
CD44 mouse monoclonal antibody, clone CVS18, Purified
Applications | FC, IHC |
Reactivities | Equine |
Conjugation | Unconjugated |
RPL22 (106-119) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Monkey, Porcine, Rabbit, Xenopus |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C-terminus of human RPL22 |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
TLR7 (900-950) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from a portion of amino acids 900-950 of Human TLR7 |
XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1. |
CD4 mouse monoclonal antibody, clone CVS4, Purified
Applications | FC, IHC, IP |
Reactivities | Equine |
Conjugation | Unconjugated |