Primary Antibodies

View as table Download

Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6.

eNOS (NOS3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthesized non-phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495(K-K-TP-F-K)

ATP citrate lyase (ACLY) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 430-480 of Human ATP-Citrate synthase.

Phospholipase C beta 3 (PLCB3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ADK rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

Tyrosine Hydroxylase (TH) pSer19 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine19 (A-V-Sp-E-Q).

Tyrosine Hydroxylase (TH) pSer19 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine19 (A-V-Sp-E-Q).

Tyrosine Hydroxylase (TH) pSer40 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 40(R-Q-SP-L-I)

Tyrosine Hydroxylase (TH) pSer40 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 40(R-Q-SP-L-I)

eNOS (NOS3) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthesized non-phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495(K-K-TP-F-K)

Rabbit Polyclonal Serotonin N-acetyltransferase Antibody

Applications IF, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen Human AANAT