Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6. |
Cytochrome P450 2A6 (CYP2A6) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 101-150 of Human CYP2A6. |
eNOS (NOS3) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized non-phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495(K-K-TP-F-K) |
ATP citrate lyase (ACLY) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 430-480 of Human ATP-Citrate synthase. |
Phospholipase C beta 3 (PLCB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ADK rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IMPDH2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD |
Tyrosine Hydroxylase (TH) pSer19 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine19 (A-V-Sp-E-Q). |
Tyrosine Hydroxylase (TH) pSer19 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of Serine19 (A-V-Sp-E-Q). |
Tyrosine Hydroxylase (TH) pSer40 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 40(R-Q-SP-L-I) |
Tyrosine Hydroxylase (TH) pSer40 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 40(R-Q-SP-L-I) |
eNOS (NOS3) rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized non-phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495(K-K-TP-F-K) |
Rabbit Polyclonal Serotonin N-acetyltransferase Antibody
Applications | IF, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | Human AANAT |