Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal SEMA3B Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I. |
Rabbit Polyclonal LIMPII/lpg85 Antibody
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114] |
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Calnexin (CANX) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Canine, Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH |
USD 665.00
2 Weeks
USD 550.00
5 Days
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Rabbit Polyclonal 5-HT7 Antibody
| Applications | FC, ICC/IF, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |
CDS1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the N-terminal region of human CDS1 |
Active filters
Reactivities
- Canine
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Category
Target Symbol
Isotypes
Clonalities
Conjugates
Assay Types
Pathways
- Neuroactive ligand-receptor interaction (4)
- Metabolic pathways (3)
- Apoptosis (2)
- Lysosome (2)
- Antigen processing and presentation (1)
- Axon guidance (1)
- Calcium signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Natural killer cell mediated cytotoxicity (1)
- Oxidative phosphorylation (1)
- Phenylalanine metabolism (1)
- Phosphatidylinositol signaling system (1)
- Toll-like receptor signaling pathway (1)
- Tyrosine metabolism (1)
- Vibrio cholerae infection (1)
- beta-Alanine metabolism (1)
- p53 signaling pathway (1)
- serine and threonine metabolism (1)