Primary Antibodies

View as table Download

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit polyclonal CDK4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4.

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

Anti-MYH11 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1958-1972 amino acids of Human myosin, heavy chain 11, smooth muscle

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

CDK4 Antibody - C-terminal region

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Anti-SRC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)

Rabbit Polyclonal beta-Actin Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 2-16 (CDDDIAALVIDNGSG) of actin protein were used as the immunogen.