NKIRAS2 (NM_001144927) Human Recombinant Protein
CAT#: TP326742
Purified recombinant protein of Homo sapiens NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226742 protein sequence
Red=Cloning site Green=Tags(s) MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138399 |
Locus ID | 28511 |
UniProt ID | Q9NYR9, A0A024R1Z4 |
Cytogenetics | 17q21.2 |
Refseq Size | 2493 |
Refseq ORF | 573 |
Synonyms | kappaB-Ras2; KBRAS2 |
Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413685 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424331 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425022 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428581 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413685 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2 |
USD 436.00 |
|
LY424331 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1 |
USD 436.00 |
|
LY428581 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3 |
USD 436.00 |
|
PH309464 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_060065) |
USD 3,255.00 |
|
PH323273 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001001349) |
USD 3,255.00 |
|
PH326742 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001138399) |
USD 3,255.00 |
|
TP309464 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2, 20 µg |
USD 867.00 |
|
TP323273 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review