DPPA5 (NM_001025290) Human Recombinant Protein
CAT#: TP322509M
Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 100 µg
Frequently bought together (2)
Other products for "DPPA5"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s) MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020461 |
Locus ID | 340168 |
UniProt ID | A6NC42 |
Cytogenetics | 6q13 |
Refseq Size | 612 |
Refseq ORF | 348 |
Synonyms | ESG1 |
Summary | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.