CHI3L2 (NM_001025197) Human Recombinant Protein
CAT#: TP320858
Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220858 representing NM_001025197
Red=Cloning site Green=Tags(s) MGATTMDQKSLWAGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVM LYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQK ENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEK PLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPG AAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIW SIDMDDFTGKSCNQGPYPLVQAVKRSLGSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020368 |
Locus ID | 1117 |
UniProt ID | Q15782 |
Cytogenetics | 1p13.2 |
Refseq Size | 1456 |
Refseq ORF | 1140 |
Synonyms | CHIL2; YKL-39; YKL39 |
Summary | The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400404 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418266 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422601 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400404 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 |
USD 436.00 |
|
LY418266 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 1 |
USD 436.00 |
|
LY422601 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 2 |
USD 436.00 |
|
PH303807 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370) |
USD 3,255.00 |
|
PH320804 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_003991) |
USD 3,255.00 |
|
PH320858 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368) |
USD 3,255.00 |
|
TP303807 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP320804 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review