PRCD (NM_001077620) Human Recombinant Protein
CAT#: TP316764
Recombinant protein of human progressive rod-cone degeneration (PRCD), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216764 representing NM_001077620
Red=Cloning site Green=Tags(s) MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 5.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001071088 |
Locus ID | 768206 |
UniProt ID | Q00LT1 |
Cytogenetics | 17q25.1 |
Refseq Size | 937 |
Refseq ORF | 162 |
Synonyms | RP36 |
Summary | This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421463 | PRCD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421463 | Transient overexpression lysate of progressive rod-cone degeneration (PRCD) |
USD 436.00 |
|
PH316764 | PRCD MS Standard C13 and N15-labeled recombinant protein (NP_001071088) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review