PRCD (NM_001077620) Human Recombinant Protein

CAT#: TP316764

Recombinant protein of human progressive rod-cone degeneration (PRCD), 20 µg

Product Images

Coomassie blue staining of purified PRCD protein (Cat# TP316764). The protein was produced from HEK293T cells transfected with PRCD cDNA clone (Cat# RC216764) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216764 representing NM_001077620
  Red=Cloning site Green=Tags(s)
  
  MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 5.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001071088
• Locus ID: 768206
• UniProt ID: Q00LT1
• Cytogenetics: 17q25.1
• Refseq Size: 937
• Refseq ORF: 162
• Synonyms: RP36
• Summary: This gene is predominantly expressed in the retina, and mutations in this gene are the cause of autosomal recessive retinal degeneration in both humans and dogs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2010]