GJA8 (NM_005267) Human Recombinant Protein

CAT#: TP313469

Recombinant protein of human gap junction protein, alpha 8, 50kDa (GJA8), 20 µg

Product Images

Coomassie blue staining of purified GJA8 protein (Cat# TP313469). The protein was produced from HEK293T cells transfected with GJA8 cDNA clone (Cat# RC213469) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213469 representing NM_005267
  Red=Cloning site Green=Tags(s)
  
  MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAF
  PISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKK
  FRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFML
  SVASVSLFLNVMELGHLGLKGIRSALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFP
  LTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKK
  EEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLS
  KASSRARSDDLTV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005258
• Locus ID: 2703
• UniProt ID: P48165, X5D7G1
• Cytogenetics: 1q21.2
• Refseq Size: 1374
• Refseq ORF: 1299
• Synonyms: CAE; CAE1; CTRCT1; CX50; CZP1; MP70
• Summary: This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. [provided by RefSeq, Dec 2009]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane