CAPS (NM_004058) Human Recombinant Protein

CAT#: TP310271L

Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 1 mg

Product Images

Coomassie blue staining of purified CAPS protein (Cat# TP310271). The protein was produced from HEK293T cells transfected with CAPS cDNA clone (Cat# RC210271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210271 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
  RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
  LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004049
• Locus ID: 828
• UniProt ID: Q13938, A0A384NYV7, Q96ET4
• Cytogenetics: 19p13.3
• Refseq Size: 1613
• Refseq ORF: 567
• Synonyms: CAPS1
• Summary: This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008]