CAPS (NM_004058) Human Tagged ORF Clone

CAT#: RC210271

CAPS (Myc-DDK-tagged)-Human calcyphosine (CAPS), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CAPS (NM_004058) Human Tagged ORF Clone
Symbol CAPS
Synonyms CAPS1; CAPS1
Vector pCMV6-Entry
Sequence Data
>RC210271 representing NM_004058
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCCGTGGATGCCACCATGGAGAAACTCCGGGCACAGTGCCTGTCCCGCGGGGCCTCGGGCATCC
AGGGCCTGGCCAGGTTTTTCCGCCAACTAGACCGGGACGGGAGCAGATCCCTGGACGCTGATGAGTTCCG
GCAGGGTCTGGCCAAACTCGGGCTGGTGCTGGACCAGGCGGAGGCAGAGGGTGTGTGCAGGAAGTGGGAC
CGCAATGGCAGCGGGACGCTGGATCTGGAGGAGTTCCTTCGGGCGCTGCGGCCCCCCATGTCCCAGGCCC
GGGAGGCTGTCATCGCAGCTGCATTTGCCAAGCTGGACCGCAGCGGGGACGGCGTCGTGACGGTGGACGA
CCTCCGCGGGGTGTACAGTGGCCGTGCCCACCCCAAGGTGCGCAGTGGGGAGTGGACCGAGGACGAGGTG
CTGCGCCGCTTCCTGGACAACTTCGACTCCTCTGAGAAGGACGGGCAGGTCACACTGGCGGAATTCCAGG
ACTACTACAGCGGCGTGAGTGCCTCCATGAACACGGATGAGGAGTTCGTGGCCATGATGACCAGTGCCTG
GCAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210271 representing NM_004058
Red=Cloning site Green=Tags(s)

MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004058
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004058.1, NM_004058.2, NM_004058.3, NP_004049
RefSeq Size 1247
RefSeq ORF 828
Locus ID 828
Cytogenetics 19p13.3
MW 20.8 kDa
Gene Summary This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)