RHOJ (NM_020663) Human Recombinant Protein

CAT#: TP309395

Recombinant protein of human ras homolog gene family, member J (RHOJ), 20 µg

Product Images

Coomassie blue staining of purified RHOJ protein (Cat# TP309395). The protein was produced from HEK293T cells transfected with RHOJ cDNA clone (Cat# RC209395) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209395 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
  LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
  PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
  CSII
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065714
• Locus ID: 57381
• UniProt ID: Q9H4E5, A0A024R692, Q7Z513
• Cytogenetics: 14q23.2
• Refseq Size: 3619
• Refseq ORF: 642
• Synonyms: ARHJ; RASL7B; TC10B; TCL
• Summary: This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome