RHOJ (NM_020663) Human Mass Spec Standard

CAT#: PH309395

RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714)

Product Images

Coomassie blue staining of purified RHOJ protein (Cat# TP309395). The protein was produced from HEK293T cells transfected with RHOJ cDNA clone (Cat# RC209395) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209395
• Predicted MW: 23.8 kDa
• Protein Sequence:
  Sequence Link

  >RC209395 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
  LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
  PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
  CSII
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065714
• RefSeq Size: 3619
• RefSeq ORF: 642
• Synonyms: ARHJ; RASL7B; TC10B; TCL
• Locus ID: 57381
• UniProt ID: Q9H4E5, A0A024R692, Q7Z513
• Cytogenetics: 14q23.2
• Summary: This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome