RHOJ (NM_020663) Human Tagged ORF Clone

CAT#: RC209395

RHOJ (Myc-DDK-tagged)-Human ras homolog gene family, member J (RHOJ)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_020663" in other vectors (6)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


RHOJ mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
    • 100 ul

USD 447.00

Other products for "RHOJ"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RHOJ
Synonyms ARHJ; RASL7B; TC10B; TCL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209395 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTGCAAAGAGGGAACTGACAGCAGCTGCGGCTGCAGGGGCAACGACGAGAAGAAGATGTTGAAGT
GTGTGGTGGTGGGGGACGGTGCCGTGGGGAAAACCTGCCTGCTGATGAGCTACGCCAACGACGCCTTCCC
AGAGGAATACGTGCCCACTGTGTTTGACCACTATGCAGTTACTGTGACTGTGGGAGGCAAGCAACACTTG
CTCGGACTGTATGACACCGCGGGACAGGAGGACTACAACCAGCTGAGGCCACTCTCCTACCCCAACACGG
ATGTGTTTTTGATCTGCTTCTCTGTCGTAAACCCTGCCTCTTACCACAATGTCCAGGAGGAATGGGTCCC
CGAGCTCAAGGACTGCATGCCTCACGTGCCTTATGTCCTCATAGGGACCCAGATTGATCTCCGTGATGAC
CCAAAAACCTTGGCCCGTTTGCTGTATATGAAAGAGAAACCTCTCACTTACGAGCATGGTGTGAAGCTCG
CAAAAGCGATCGGAGCACAGTGCTACTTGGAATGTTCAGCTCTGACTCAGAAAGGTCTCAAAGCGGTTTT
TGATGAAGCAATCCTCACCATTTTCCACCCCAAGAAAAAGAAGAAACGCTGTTCTGAGGGTCACAGCTGC
TGTTCAATTATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209395 protein sequence
Red=Cloning site Green=Tags(s)

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC
CSII

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020663
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020663.5
RefSeq Size 3619 bp
RefSeq ORF 645 bp
Locus ID 57381
UniProt ID Q9H4E5
Cytogenetics 14q23.2
Domains ras, RAS, RHO, RAB
Protein Families Druggable Genome
MW 23.8 kDa
Gene Summary This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.