SOHLH1 (NM_001012415) Human Recombinant Protein

CAT#: TP307282

Recombinant protein of human spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified SOHLH1 protein (Cat# TP307282). The protein was produced from HEK293T cells transfected with SOHLH1 cDNA clone (Cat# RC207282) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207282 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS
  LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI
  QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC
  QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGSLAMGAAPLGEP
  AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001012415
• Locus ID: 402381
• UniProt ID: Q5JUK2
• Cytogenetics: 9q34.3
• Refseq Size: 1997
• Refseq ORF: 984
• Synonyms: bA100C15.3; bHLHe80; C9orf157; NOHLH; ODG5; SPATA27; SPGF32; TEB2
• Summary: This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 9. Mutations in this gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]