SOHLH1 (NM_001012415) Human Mass Spec Standard

CAT#: PH307282

SOHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_001012415)

Product Images

Coomassie blue staining of purified SOHLH1 protein (Cat# TP307282). The protein was produced from HEK293T cells transfected with SOHLH1 cDNA clone (Cat# RC207282) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207282
• Predicted MW: 34.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207282 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS
  LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI
  QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC
  QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGSLAMGAAPLGEP
  AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001012415
• RefSeq Size: 1997
• RefSeq ORF: 984
• Synonyms: bA100C15.3; bHLHe80; C9orf157; NOHLH; ODG5; SPATA27; SPGF32; TEB2
• Locus ID: 402381
• UniProt ID: Q5JUK2
• Cytogenetics: 9q34.3
• Summary: This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 9. Mutations in this gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]