SOHLH1 Rabbit Polyclonal Antibody

CAT#: TA332267

Rabbit Polyclonal Anti-SOHLH1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 1
    • 100 ug

USD 436.00

Other products for "SOHLH1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SOHLH1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SOHLH1. Synthetic peptide located within the following region: MGAAPLGEPAKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name spermatogenesis and oogenesis specific basic helix-loop-helix 1
Background This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 9. Mutations in this gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms bA100C15.3; bHLHe80; C9orf157; NOHLH; SPATA27; TEB2
Note Immunogen sequence homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.