TSEN2 (NM_025265) Human Recombinant Protein
CAT#: TP305156
Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205156 protein sequence
Red=Cloning site Green=Tags(s) MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079541 |
Locus ID | 80746 |
UniProt ID | Q8NCE0, A0A024R2G3 |
Cytogenetics | 3p25.2 |
Refseq Size | 2402 |
Refseq ORF | 1395 |
Synonyms | PCH2B; SEN2; SEN2L |
Summary | This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410823 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428856 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428858 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428859 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410823 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1 |
USD 436.00 |
|
LY428856 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2 |
USD 436.00 |
|
LY428858 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 4 |
USD 436.00 |
|
LY428859 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 5 |
USD 436.00 |
|
PH305156 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_079541) |
USD 3,255.00 |
|
PH326917 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_001138864) |
USD 3,255.00 |
|
TP326917 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review