TSEN2 (NM_025265) Human Mass Spec Standard
CAT#: PH305156
TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_079541)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205156 |
Predicted MW | 53.2 kDa |
Protein Sequence |
>RC205156 protein sequence
Red=Cloning site Green=Tags(s) MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQLYGKGYFGKGI LSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPP VKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTESFEKSV REDASPLPHVCCCKQDALILQRGLHHEDGSQHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQ RNRLICRRNPYRIFEYLQLSLEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFR SKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079541 |
RefSeq Size | 2402 |
RefSeq ORF | 1395 |
Synonyms | PCH2B; SEN2; SEN2L |
Locus ID | 80746 |
UniProt ID | Q8NCE0, A0A024R2G3 |
Cytogenetics | 3p25.2 |
Summary | This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410823 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428856 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428858 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428859 | TSEN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410823 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1 |
USD 436.00 |
|
LY428856 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2 |
USD 436.00 |
|
LY428858 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 4 |
USD 436.00 |
|
LY428859 | Transient overexpression lysate of tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 5 |
USD 436.00 |
|
PH326917 | TSEN2 MS Standard C13 and N15-labeled recombinant protein (NP_001138864) |
USD 3,255.00 |
|
TP305156 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP326917 | Recombinant protein of human tRNA splicing endonuclease 2 homolog (S. cerevisiae) (TSEN2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review