MD2 (LY96) (NM_015364) Human Recombinant Protein

CAT#: TP304686M

Recombinant protein of human lymphocyte antigen 96 (LY96), 100 µg

Product Images

Coomassie blue staining of purified LY96 protein (Cat# TP304686). The protein was produced from HEK293T cells transfected with LY96 cDNA clone (Cat# RC204686) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204686 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD
  LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG
  SPEEMLFCLEFVILHQPNSN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Ex vivo tissue treatment (PMID: 25605324)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056179
• Locus ID: 23643
• UniProt ID: Q9Y6Y9
• Cytogenetics: 8q21.11
• Refseq Size: 642
• Refseq ORF: 480
• Synonyms: ESOP-1; ly-96; MD-2; MD2
• Summary: This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010]
• Protein Families: Secreted Protein
• Protein Pathways: Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway