MD2 (LY96) (NM_015364) Human Tagged ORF Clone

CAT#: RC204686

Reviews ()
Write a review

LY96 (Myc-DDK-tagged)-Human lymphocyte antigen 96 (LY96), transcript variant 1

  View "NM_015364" in other vectors (10)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MD2 (LY96) (NM_015364) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LY96
Synonyms ESOP-1; ly-96; MD-2; MD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204686 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCATTTCTGTTTTTTTCCACCCTGTTTTCTTCCATATTTACTGAAGCTCAGAAGCAGTATTGGG
TCTGCAACTCATCCGATGCAAGTATTTCATACACCTACTGTGATAAAATGCAATACCCAATTTCAATTAA
TGTTAACCCCTGTATAGAATTGAAAGGATCCAAAGGATTATTGCACATTTTCTACATTCCAAGGAGAGAT
TTAAAGCAATTATATTTCAATCTCTATATAACTGTCAACACCATGAATCTTCCAAAGCGCAAAGAAGTTA
TTTGCCGAGGATCTGATGACGATTACTCTTTTTGCAGAGCTCTGAAGGGAGAGACTGTGAATACAACAAT
ATCATTCTCCTTCAAGGGAATAAAATTTTCTAAGGGAAAATACAAATGTGTTGTTGAAGCTATTTCTGGG
AGCCCAGAAGAAATGCTCTTTTGCTTGGAGTTTGTCATCCTACACCAACCTAATTCAAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204686 protein sequence
Red=Cloning site Green=Tags(s)

MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD
LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG
SPEEMLFCLEFVILHQPNSN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015364
ORF Size 480 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015364.1, NM_015364.2, NM_015364.3, NM_015364.4, NP_056179.1
RefSeq Size 642
RefSeq ORF 483
Locus ID 23643
Cytogenetics 8q21.11
Protein Families Secreted Protein
Protein Pathways Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway
MW 18.4 kDa
Gene Summary This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010]

Other Versions

Other products for "LY96"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-LY96 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones