GADD45A (NM_001924) Human Recombinant Protein
CAT#: TP304005M
Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A), 100 µg
Frequently bought together (2)
Other products for "GADD45A"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204005 protein sequence
Red=Cloning site Green=Tags(s) MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL SQLICFCRESRYMDQWVPVINLPER myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001915 |
Locus ID | 1647 |
UniProt ID | P24522 |
Cytogenetics | 1p31.3 |
Refseq Size | 1398 |
Refseq ORF | 495 |
Synonyms | DDIT1; GADD45 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.