GADD45A (NM_001924) Human Recombinant Protein

CAT#: TP304005M

Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A), 100 µg

Product Images

Coomassie blue staining of purified GADD45A protein (Cat# TP304005). The protein was produced from HEK293T cells transfected with GADD45A cDNA clone (Cat# RC204005) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204005 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA
  LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL
  SQLICFCRESRYMDQWVPVINLPER
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001915
• Locus ID: 1647
• UniProt ID: P24522
• Cytogenetics: 1p31.3
• Refseq Size: 1398
• Refseq ORF: 495
• Synonyms: DDIT1; GADD45
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway