CAB39L (NM_030925) Human Recombinant Protein
CAT#: TP303394
Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203394 protein sequence
Red=Cloning site Green=Tags(s) MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112187 |
Locus ID | 81617 |
UniProt ID | Q9H9S4, A0A024RDT3, Q86WE6 |
Cytogenetics | 13q14.2 |
Refseq Size | 3631 |
Refseq ORF | 1011 |
Synonyms | bA103J18.3; MO2L; MO25-BETA |
Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410660 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421532 | CAB39L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410660 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 1 |
USD 436.00 |
|
LY421532 | Transient overexpression lysate of calcium binding protein 39-like (CAB39L), transcript variant 2 |
USD 436.00 |
|
PH303394 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_112187) |
USD 3,255.00 |
|
PH311881 | CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138) |
USD 3,255.00 |
|
TP311881 | Recombinant protein of human calcium binding protein 39-like (CAB39L), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review