CAB39L (NM_001079670) Human Mass Spec Standard

CAT#: PH311881

CAB39L MS Standard C13 and N15-labeled recombinant protein (NP_001073138)

Product Images

Coomassie blue staining of purified CAB39L protein (Cat# TP311881). The protein was produced from HEK293T cells transfected with CAB39L cDNA clone (Cat# RC211881) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211881
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211881 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA
  QELYSSGLLVTLIADLQLIDFEEKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL
  RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF
  EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF
  VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073138
• RefSeq Size: 3580
• RefSeq ORF: 1011
• Synonyms: bA103J18.3; MO2L; MO25-BETA
• Locus ID: 81617
• UniProt ID: Q9H9S4, A0A024RDT3
• Cytogenetics: 13q14.2
• Summary: Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: mTOR signaling pathway