GNPDA2 (NM_138335) Human Recombinant Protein

CAT#: TP302194

Recombinant protein of human glucosamine-6-phosphate deaminase 2 (GNPDA2), 20 µg

Product Images

Coomassie blue staining of purified GNPDA2 protein (Cat# TP302194). The protein was produced from HEK293T cells transfected with GNPDA2 cDNA clone (Cat# RC202194) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202194 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN
  MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP
  DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAF
  ALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612208
• Locus ID: 132789
• UniProt ID: Q8TDQ7, A0A024R9X5
• Cytogenetics: 4p12
• Refseq Size: 2313
• Refseq ORF: 420
• Synonyms: GNP2; SB52
• Summary: The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Metabolic pathways