OBFC1 (STN1) (NM_024928) Human Recombinant Protein
CAT#: TP300778
Recombinant protein of human oligonucleotide/oligosaccharide-binding fold containing 1 (OBFC1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200778 protein sequence
Red=Cloning site Green=Tags(s) MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERD AFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRT YREEREIHATAYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSE KAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLV FQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLEL LEDQSDIVSTMEHYYTAF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079204 |
Locus ID | 79991 |
UniProt ID | Q9H668 |
Cytogenetics | 10q24.33 |
Refseq Size | 6483 |
Refseq ORF | 1104 |
Synonyms | AAF-44; AAF44; bA541N10.2; OBFC1; RPA-32 |
Summary | OBFC1 and C17ORF68 (MIM 613129) are subunits of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase (see MIM 176636), the enzyme that initiates DNA replication (Casteel et al., 2009 [PubMed 19119139]). OBFC1 also appears to function in a telomere-associated complex with C17ORF68 and TEN1 (C17ORF106; MIM 613130) (Miyake et al., 2009 [PubMed 19854130]).[supplied by OMIM, Nov 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410967 | OBFC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410967 | Transient overexpression lysate of oligonucleotide/oligosaccharide-binding fold containing 1 (OBFC1) |
USD 436.00 |
|
PH300778 | OBFC1 MS Standard C13 and N15-labeled recombinant protein (NP_079204) |
USD 3,255.00 |
|
TP720943 | Purified recombinant protein of Human oligonucleotide/oligosaccharide-binding fold containing 1 (OBFC1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review