ESD (NM_001984) Human Recombinant Protein
CAT#: TP300533
Recombinant protein of human esterase D/formylglutathione hydrolase (ESD), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200533 protein sequence
Red=Cloning site Green=Tags(s) MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL NA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001975 |
Locus ID | 2098 |
UniProt ID | P10768, A0A140VJJ2 |
Cytogenetics | 13q14.2 |
Refseq Size | 1208 |
Refseq ORF | 846 |
Synonyms | FGH |
Summary | This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419606 | ESD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419606 | Transient overexpression lysate of esterase D/formylglutathione hydrolase (ESD) |
USD 436.00 |
|
PH300533 | ESD MS Standard C13 and N15-labeled recombinant protein (NP_001975) |
USD 3,255.00 |
|
TP720113 | Recombinant protein of human esterase D/formylglutathione hydrolase (ESD) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review