CCBL2 (KYAT3) (NM_001008662) Human Mass Spec Standard
CAT#: PH317351
CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008662)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217351 |
Predicted MW | 47.6 kDa |
Protein Sequence |
>RC217351 representing NM_001008662
Red=Cloning site Green=Tags(s) MSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHP SLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPV FIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCI SDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCA TPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDL SDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001008662 |
RefSeq Size | 1938 |
RefSeq ORF | 1260 |
Synonyms | CCBL2; KAT3; KATIII |
Locus ID | 56267 |
UniProt ID | Q6YP21 |
Cytogenetics | 1p22.2 |
Summary | This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423344 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC423345 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY423344 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1 |
USD 665.00 |
|
LY423345 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2 |
USD 665.00 |
|
PH314155 | CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008661) |
USD 3,255.00 |
|
TP314155 | Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP317351 | Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review