OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCBL2 (KYAT3) (NM_001008662) Human Mass Spec Standard

Be the first to review this product
SKU
PH317351
CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008662)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345720 Rabbit Polyclonal Anti-RP11-82K18.3 Antibody
100 ul
$525.00
LY423344 Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "CCBL2 or NM_001008662"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217351
Predicted MW 47.6 kDa
Protein Sequence
Protein Sequence
>RC217351 representing NM_001008662
Red=Cloning site Green=Tags(s)

MSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHP
SLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPV
FIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCI
SDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCA
TPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDL
SDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008662
RefSeq Size 1938
RefSeq ORF 1260
Synonyms CCBL2; KAT3; KATIII
Locus ID 56267
UniProt ID Q6YP21
Cytogenetics 1p22.2
Summary This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. provided by RefSeq, Mar 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCBL2" proteins (7)
SKU Description Size Price
PH314155 CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008661) 10 ug
$3,360.00
LC423344 Lyophilized CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423345 Lyophilized CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423344 Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY423345 Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP314155 Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg 20 ug
$867.00
TP317351 Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products