CCBL2 (KYAT3) (NM_001008661) Human Recombinant Protein

CAT#: TP314155

Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified KYAT3 protein (Cat# TP314155). The protein was produced from HEK293T cells transfected with KYAT3 cDNA clone (Cat# RC214155) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214155 representing NM_001008661
  Red=Cloning site Green=Tags(s)
  
  MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQ
  GFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFN
  TIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKA
  IILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGK
  TFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKR
  DRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
  KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001008661
• Locus ID: 56267
• UniProt ID: Q6YP21, B4DW13
• Cytogenetics: 1p22.2
• Refseq Size: 2038
• Refseq ORF: 1362
• Synonyms: CCBL2; KAT3; KATIII
• Summary: This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017]