ER81 (ETV1) (NM_004956) Human Mass Spec Standard
CAT#: PH310533
ETV1 MS Standard C13 and N15-labeled recombinant protein (NP_004947)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210533 |
Predicted MW | 55.1 kDa |
Protein Sequence |
>RC210533 protein sequence
Red=Cloning site Green=Tags(s) MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004947 |
RefSeq Size | 6824 |
RefSeq ORF | 1431 |
Synonyms | ER81 |
Locus ID | 2115 |
UniProt ID | P50549 |
Cytogenetics | 7p21.2 |
Summary | This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016] |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401540 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431330 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431362 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431376 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431397 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401540 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 1 |
USD 436.00 |
|
LY431330 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 7 |
USD 436.00 |
|
LY431362 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 6 |
USD 436.00 |
|
LY431376 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 5 |
USD 436.00 |
|
LY431397 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 2 |
USD 436.00 |
|
TP310533 | Recombinant protein of human ets variant 1 (ETV1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review