ER81 (ETV1) (NM_004956) Human Tagged ORF Clone

CAT#: RC210533

Reviews ()
Write a review

ETV1 (Myc-DDK-tagged)-Human ets variant 1 (ETV1), transcript variant 1



  "NM_004956" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ETV1
Synonyms ER81
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210533 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGATTTTATGACCAGCAAGTGCCTTACATGGTCACCAATAGTCAGCGTGGGAGAAATTGTAACG
AGAAACCAACAAATGTCAGGAAAAGAAAATTCATTAACAGAGATCTGGCTCATGATTCAGAAGAACTCTT
TCAAGATCTAAGTCAATTACAGGAAACATGGCTTGCAGAAGCTCAGGTACCTGACAATGATGAGCAGTTT
GTACCAGACTATCAGGCTGAAAGTTTGGCTTTTCATGGCCTGCCACTGAAAATCAAGAAAGAACCCCACA
GTCCATGTTCAGAAATCAGCTCTGCCTGCAGTCAAGAACAGCCCTTTAAATTCAGCTATGGAGAAAAGTG
CCTGTACAATGTCAGTGCCTATGATCAGAAGCCACAAGTGGGAATGAGGCCCTCCAACCCCCCCACACCA
TCCAGCACGCCAGTGTCCCCACTGCATCATGCATCTCCAAACTCAACTCATACACCGAAACCTGACCGGG
CCTTCCCAGCTCACCTCCCTCCATCGCAGTCCATACCAGATAGCAGCTACCCCATGGACCACAGATTTCG
CCGCCAGCTTTCTGAACCCTGTAACTCCTTTCCTCCTTTGCCGACGATGCCAAGGGAAGGACGTCCTATG
TACCAACGCCAGATGTCTGAGCCAAACATCCCCTTCCCACCACAAGGCTTTAAGCAGGAGTACCACGACC
CAGTGTATGAACACAACACCATGGTTGGCAGTGCGGCCAGCCAAAGCTTTCCCCCTCCTCTGATGATTAA
ACAGGAACCCAGAGATTTTGCATATGACTCAGAAGTGCCTAGCTGCCACTCCATTTATATGAGGCAAGAA
GGCTTCCTGGCTCATCCCAGCAGAACAGAAGGCTGTATGTTTGAAAAGGGCCCCAGGCAGTTTTATGATG
ACACCTGTGTTGTCCCAGAAAAATTCGATGGAGACATCAAACAAGAGCCAGGAATGTATCGGGAAGGACC
CACATACCAACGGCGAGGATCACTTCAGCTCTGGCAGTTTTTGGTAGCTCTTCTGGATGACCCTTCAAAT
TCTCATTTTATTGCCTGGACTGGTCGAGGCATGGAATTTAAACTGATTGAGCCTGAAGAGGTGGCCCGAC
GTTGGGGCATTCAGAAAAACAGGCCAGCTATGAACTATGATAAACTTAGCCGTTCACTCCGCTATTACTA
TGAGAAAGGAATTATGCAAAAGGTGGCTGGAGAGAGATATGTCTACAAGTTTGTGTGTGATCCAGAAGCC
CTTTTCTCCATGGCCTTTCCAGATAATCAGCGTCCACTGCTGAAGACAGACATGGAACGTCACATCAACG
AGGAGGACACAGTGCCTCTTTCTCACTTTGATGAGAGCATGGCCTACATGCCGGAAGGGGGCTGCTGCAA
CCCCCACCCCTACAACGAAGGCTACGTGTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210533 protein sequence
Red=Cloning site Green=Tags(s)

MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF
VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP
SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM
YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE
GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN
SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004956
ORF Size 1431 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004956.5
RefSeq Size 6824 bp
RefSeq ORF 1434 bp
Locus ID 2115
UniProt ID P50549
Cytogenetics 7p21.2
Domains ETS, ETS_PEA3_N
Protein Families ES Cell Differentiation/IPS, Transcription Factors
MW 55.1 kDa
Gene Summary This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016]

Other Versions

Other products for "ETV1"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.