CAPS (NM_004058) Human Mass Spec Standard
CAT#: PH310271
CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210271 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC210271 protein sequence
Red=Cloning site Green=Tags(s) MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004049 |
RefSeq Size | 1613 |
RefSeq ORF | 567 |
Synonyms | CAPS1 |
Locus ID | 828 |
UniProt ID | Q13938, A0A384NYV7, Q96ET4 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409138 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418250 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409138 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 |
USD 436.00 |
|
LY418250 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1 |
USD 436.00 |
|
PH315422 | CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157) |
USD 3,255.00 |
|
TP310271 | Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg |
USD 867.00 |
|
TP315422 | Recombinant protein of human calcyphosine (CAPS), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review