CAPS (NM_004058) Human Mass Spec Standard

CAT#: PH310271

CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049)

Product Images

Coomassie blue staining of purified CAPS protein (Cat# TP310271). The protein was produced from HEK293T cells transfected with CAPS cDNA clone (Cat# RC210271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210271
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC210271 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD
  RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEV
  LRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004049
• RefSeq Size: 1613
• RefSeq ORF: 567
• Synonyms: CAPS1
• Locus ID: 828
• UniProt ID: Q13938, A0A384NYV7, Q96ET4
• Cytogenetics: 19p13.3
• Summary: This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008]