TYW3 (NM_138467) Human Mass Spec Standard

CAT#: PH310021

TYW3 MS Standard C13 and N15-labeled recombinant protein (NP_612476)

Product Images

Coomassie blue staining of purified TYW3 protein (Cat# TP310021). The protein was produced from HEK293T cells transfected with TYW3 cDNA clone (Cat# RC210021) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210021
• Predicted MW: 29.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210021 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC
  CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT
  MLVVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE
  KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612476
• RefSeq Size: 3448
• RefSeq ORF: 777
• Synonyms: C1orf171
• Locus ID: 127253
• UniProt ID: Q6IPR3
• Cytogenetics: 1p31.1
• Summary: Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM, Mar 2008]