OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TYW3 (NM_138467) Human Mass Spec Standard

Be the first to review this product
SKU
PH310021
TYW3 MS Standard C13 and N15-labeled recombinant protein (NP_612476)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320095 Rabbit Polyclonal TYW3 Antibody
100 ug
$640.00
LY431186 Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TYW3 or NM_138467"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210021
Predicted MW 29.8 kDa
Protein Sequence
Protein Sequence
>RC210021 protein sequence
Red=Cloning site Green=Tags(s)

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC
CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT
MLVVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE
KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612476
RefSeq Size 3448
RefSeq ORF 777
Synonyms C1orf171
Locus ID 127253
UniProt ID Q6IPR3
Cytogenetics 1p31.1
Summary Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TYW3" proteins (5)
SKU Description Size Price
LC408593 Lyophilized TYW3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431186 Lyophilized TYW3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408593 Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431186 Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310021 Recombinant protein of human tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products