Protein phosphatase inhibitor 1 (PPP1R1A) (NM_006741) Human Mass Spec Standard

CAT#: PH305263

PPP1R1A MS Standard C13 and N15-labeled recombinant protein (NP_006732)

Product Images

Coomassie blue staining of purified PPP1R1A protein (Cat# TP305263). The protein was produced from HEK293T cells transfected with PPP1R1A cDNA clone (Cat# RC205263) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205263
• Predicted MW: 18.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205263 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ
  RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI
  PKTHERGSKEPSTKEPSTHIPPLDSKGANSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006732
• RefSeq Size: 1849
• RefSeq ORF: 513
• Synonyms: I1; IPP1
• Locus ID: 5502
• UniProt ID: Q13522
• Cytogenetics: 12q13.2
• Summary: Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Long-term potentiation