Protein phosphatase inhibitor 1 (PPP1R1A) (NM_006741) Human Recombinant Protein

CAT#: TP305263

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A), 20 µg

Product Images

Coomassie blue staining of purified PPP1R1A protein (Cat# TP305263). The protein was produced from HEK293T cells transfected with PPP1R1A cDNA clone (Cat# RC205263) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205263 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ
  RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI
  PKTHERGSKEPSTKEPSTHIPPLDSKGANSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006732
• Locus ID: 5502
• UniProt ID: Q13522
• Cytogenetics: 12q13.2
• Refseq Size: 1849
• Refseq ORF: 513
• Synonyms: I1; IPP1
• Summary: Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Long-term potentiation