MOSC2 (MARC2) (NM_017898) Human Mass Spec Standard
CAT#: PH303877
MOSC2 MS Standard C13 and N15-labeled recombinant protein (NP_060368)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203877 |
Predicted MW | 38 kDa |
Protein Sequence |
>RC203877 protein sequence
Red=Cloning site Green=Tags(s) MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKLWIYPVKSCKG VPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQP SSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYC PLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPD TGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060368 |
RefSeq Size | 1618 |
RefSeq ORF | 1005 |
Synonyms | MARC2; MOSC2 |
Locus ID | 54996 |
UniProt ID | Q969Z3 |
Cytogenetics | 1q41 |
Summary | The protein encoded by this gene is an enzyme found in the outer mitochondrial membrane that reduces N-hydroxylated substrates. The encoded protein uses molybdenum as a cofactor and cytochrome b5 type B and NADH cytochrome b5 reductase as accessory proteins. One type of substrate used is N-hydroxylated nucleotide base analogues, which can be toxic to a cell. Other substrates include N(omega)-hydroxy-L-arginine (NOHA) and amidoxime prodrugs, which are activated by the encoded enzyme. Multiple transcript variants encoding the different isoforms have been found for this gene. [provided by RefSeq, Sep 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413480 | 42065 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413480 | Transient overexpression lysate of MOCO sulphurase C-terminal domain containing 2 (MOSC2) |
USD 436.00 |
|
TP303877 | Recombinant protein of human MOCO sulphurase C-terminal domain containing 2 (MOSC2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review