TFIIF (GTF2F1) (NM_002096) Human Mass Spec Standard

CAT#: PH301294

GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)

Product Images

Coomassie blue staining of purified GTF2F1 protein (Cat# TP301294). The protein was produced from HEK293T cells transfected with GTF2F1 cDNA clone (Cat# RC201294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201294
• Predicted MW: 58.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE
  FNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV
  HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL
  EDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
  SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE
  SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
  KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV
  NVLAQILKRLNPERKMINDKMHFSLKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002087
• RefSeq Size: 2551
• RefSeq ORF: 1551
• Synonyms: BTF4; RAP74; TF2F1; TFIIF
• Locus ID: 2962
• UniProt ID: P35269
• Cytogenetics: 19p13.3
• Summary: TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors