TFIIF (GTF2F1) (NM_002096) Human Recombinant Protein

CAT#: TP301294M

Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 100 µg

Product Images

Coomassie blue staining of purified GTF2F1 protein (Cat# TP301294). The protein was produced from HEK293T cells transfected with GTF2F1 cDNA clone (Cat# RC201294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSE
  FNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPV
  HNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDL
  EDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
  SQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE
  SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
  KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTV
  NVLAQILKRLNPERKMINDKMHFSLKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002087
• Locus ID: 2962
• UniProt ID: P35269
• Cytogenetics: 19p13.3
• Refseq Size: 2551
• Refseq ORF: 1551
• Synonyms: BTF4; RAP74; TF2F1; TFIIF
• Summary: TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors