KCTD15 (NM_024076) Human Mass Spec Standard

CAT#: PH300838

KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981)

Product Images

Coomassie blue staining of purified KCTD15 protein (Cat# TP300838). The protein was produced from HEK293T cells transfected with KCTD15 cDNA clone (Cat# RC200838) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200838
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200838 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS
  LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY
  YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN
  QDPTHVIRFPLNGYCRLNSVQDVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076981
• RefSeq Size: 4935
• RefSeq ORF: 702
• Locus ID: 79047
• UniProt ID: Q96SI1
• Cytogenetics: 19q13.11
• Summary: During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function]
• Protein Families: Ion Channels: Other