KCTD15 (NM_024076) Human Tagged ORF Clone

CAT#: RC200838

Reviews ()
Write a review

KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1

  View "NM_024076" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCTD15 (NM_024076) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCTD15
Synonyms MGC2628; MGC25497
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200838 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCACCGCAAGGAGCGGCCGAGCGGGTCCTCGCTTCACACACACGGCAGCACCGGCACCGCGGAGG
GAGGAAACATGTCCCGGCTGTCTCTCACCCGGTCGCCTGTGTCTCCCCTGGCTGCCCAGGGCATCCCCCT
GCCAGCCCAGCTCACCAAGTCCAATGCACCTGTGCACATCGATGTGGGCAGCCACATGTACACCAGCAGC
CTGGCCACGCTCACCAAGTACCCTGACTCCAGGATAAGCCGCCTCTTCAATGGCACTGAACCCATCGTCC
TGGACAGTTTGAAGCAACATTATTTCATTGACCGGGATGGGGAGATTTTCCGCTACGTCCTGAGCTTCCT
GCGGACGTCCAAGCTGCTGCTTCCGGATGACTTTAAGGACTTCAGTCTGCTGTACGAGGAGGCGCGCTAC
TATCAGCTCCAGCCCATGGTGCGCGAGCTGGAGCGCTGGCAGCAGGAGCAGGAGCAGCGGCGCCGCAGCC
GGGCCTGTGACTGCCTGGTGGTGCGCGTCACGCCCGACTTGGGCGAGCGGATCGCACTCAGCGGCGAGAA
GGCCCTCATCGAGGAGGTCTTCCCCGAGACCGGAGACGTCATGTGCAACTCCGTCAACGCCGGCTGGAAC
CAGGACCCCACGCACGTCATCCGCTTCCCGCTCAATGGCTACTGCCGGCTCAACTCGGTACAGGATGTTC
TA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200838 protein sequence
Red=Cloning site Green=Tags(s)

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN
QDPTHVIRFPLNGYCRLNSVQDVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024076
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024076.1, NM_024076.2, NP_076981.1
RefSeq Size 4935
RefSeq ORF 705
Locus ID 79047
Cytogenetics 19q13.11
Domains BTB, K_tetra
Protein Families Ion Channels: Other
MW 26.5 kDa

Other Versions

Other products for "KCTD15"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal KCTD15 Antibody
    • 100 ug

USD 430.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones