HSPC152 (TRMT112) (NM_016404) Human Mass Spec Standard

CAT#: PH300036

TRMT112 MS Standard C13 and N15-labeled recombinant protein (NP_057488)

Product Images

Coomassie blue staining of purified TRMT112 protein (Cat# TP300036). The protein was produced from HEK293T cells transfected with TRMT112 cDNA clone (Cat# RC200036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200036
• Predicted MW: 14.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200036 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP
  VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057488
• RefSeq Size: 1305
• RefSeq ORF: 375
• Synonyms: HSPC152; HSPC170; hTrm112; TRM112; TRMT11-2
• Locus ID: 51504
• UniProt ID: Q9UI30, A0A024R565
• Cytogenetics: 11q13.1
• Summary: Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604).[UniProtKB/Swiss-Prot Function]