HSPC152 (TRMT112) (NM_016404) Human Recombinant Protein
CAT#: TP300036
Recombinant protein of human hypothetical protein HSPC152 (HSPC152), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200036 protein sequence
Red=Cloning site Green=Tags(s) MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057488 |
Locus ID | 51504 |
UniProt ID | Q9UI30, A0A024R565 |
Cytogenetics | 11q13.1 |
Refseq Size | 1305 |
Refseq ORF | 375 |
Synonyms | HSPC152; HSPC170; hTrm112; TRM112; TRMT11-2 |
Summary | Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414001 | TRMT112 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414001 | Transient overexpression lysate of tRNA methyltransferase 11-2 homolog (S. cerevisiae) (TRMT112) |
USD 436.00 |
|
PH300036 | TRMT112 MS Standard C13 and N15-labeled recombinant protein (NP_057488) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review