UL144 (NC_006273) Virus Tagged ORF Clone

CAT#: VC101305

Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL144 [Human herpesvirus 5], codon optimized for human cell expression, YP_081573

Specifications

Product Data

• Type: Virus Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: UL144
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >The Viral ORF clone VC101305 represents NCBI reference of YP_081573 with codon optimized for human cell expression
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGCCCCTGGTGATGCTGATCTGCTTCGGCGTGATCCTCCTGCAGCTGGGCGTGACAAAGGTGTGCC
  AGCATAACGAGGTGCAGCTGGGAAACGAGTGCTGCCCCCCCTGCGGCCTGGGCCAGCGGGTGACCAAGGT
  GTGTACCGAGCGGACCAGCGTGACCTGCACTCCCTGCCCCAACGGCACCTACGTGAGCGGCCTGTACAAC
  TGCACCGACTGCACCCAATGTAACGTGACCCAGGTGATGATCCGGAACTGCACCAGCACCAACAACACTG
  TCTGCGCCCCCAAGAACCACACCTACTTCAGCACCCCCGGCGTGCAGCACCACAAACAGCGGCAGCAGAA
  CCACACCGCACATATCACCGTCAAGCAGGGCAAGTCCGGCCGGCACACCCTGGCCTGGCTCAGCCTGTTC
  ATCTTCCTGGTGGGCATCATCCTGCTGATCCTGTACCTGATCGCCGCCTACCGGAGCGAGCGGTGTCAGC
  AGTGCTGTAGCATCGGCAAGATCTTCTACCGGACTCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >VC101305 representing YP_081573
  Red=Cloning sites Green=Tags
  
  MKPLVMLICFGVILLQLGVTKVCQHNEVQLGNECCPPCGLGQRVTKVCTERTSVTCTPCPNGTYVSGLYN
  CTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF
  IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL
  
  TRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NC_006273
• ORF Size: 528 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NC_006273.2, YP_081573
• RefSeq ORF: 528 bp
• Locus ID: 3077471
• MW: 19.6 kDa